Scientific Gget
'Fast CLI/Python queries to 20+ bioinformatics databases. Use for quick lookups: gene info, BLAST searches, AlphaFold structures, enrichment analysis. Best for interactive exploration, simple queries. For batch processing or advanced BLAST use bio...
You need a gene's function, its protein structure from AlphaFold, and an enrichment analysis — but each database has a different API and query format. gget provides a single CLI and Python interface to 20+ bioinformatics databases, turning what used to be hours of web browsing into one-line lookups.
Who it's for: biologists looking up gene information without navigating multiple web databases, bioinformaticians running quick BLAST searches and enrichment analyses from the command line, graduate students exploring gene function and protein structure for their research, computational biologists prototyping queries before building full pipelines, wet lab scientists needing fast programmatic access to Ensembl and UniProt data
Example
"Look up TP53 gene info, get its AlphaFold structure, and run enrichment on its interacting genes" → gget workflow: gene information retrieval from Ensembl, AlphaFold structure download and visualization, protein-protein interaction network query, GO enrichment analysis on interactors, and a summary table linking gene function to structural features
New here? 3-minute setup guide → | Already set up? Copy the template below.
# gget
## Overview
gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.
**Important**: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.
## Installation
Install gget in a clean virtual environment to avoid conflicts:
```bash
# Using uv (recommended)
uv uv pip install gget
# Or using pip
uv pip install --upgrade gget
# In Python/Jupyter
import gget
```
## Quick Start
Basic usage pattern for all modules:
```bash
# Command-line
gget <module> [arguments] [options]
# Python
gget.module(arguments, options)
```
Most modules return:
- **Command-line**: JSON (default) or CSV with `-csv` flag
- **Python**: DataFrame or dictionary
Common flags across modules:
- `-o/--out`: Save results to file
- `-q/--quiet`: Suppress progress information
- `-csv`: Return CSV format (command-line only)
## Module Categories
### 1. Reference & Gene Information
#### gget ref - Reference Genome Downloads
Retrieve download links and metadata for Ensembl reference genomes.
**Parameters**:
- `species`: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'
- `-w/--which`: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all
- `-r/--release`: Ensembl release number (default: latest)
- `-l/--list_species`: List available vertebrate species
- `-liv/--list_iv_species`: List available invertebrate species
- `-ftp`: Return only FTP links
- `-d/--download`: Download files (requires curl)
**Examples**:
```bash
# List available species
gget ref --list_species
# Get all reference files for human
gget ref homo_sapiens
# Download only GTF annotation for mouse
gget ref -w gtf -d mouse
```
```python
# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which="gtf", download=True)
```
#### gget search - Gene Search
Locate genes by name or description across species.
**Parameters**:
- `searchwords`: One or more search terms (case-insensitive)
- `-s/--species`: Target species (e.g., 'homo_sapiens', 'mouse')
- `-r/--release`: Ensembl release number
- `-t/--id_type`: Return 'gene' (default) or 'transcript'
- `-ao/--andor`: 'or' (default) finds ANY searchword; 'and' requires ALL
- `-l/--limit`: Maximum results to return
**Returns**: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL
**Examples**:
```bash
# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric
# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription
```
```python
# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
```
#### gget info - Gene/Transcript Information
Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.
**Parameters**:
- `ens_ids`: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs
- `-n/--ncbi`: Disable NCBI data retrieval
- `-u/--uniprot`: Disable UniProt data retrieval
- `-pdb`: Include PDB identifiers (increases runtime)
**Returns**: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript
**Examples**:
```bash
# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296
# Include PDB IDs
gget info ENSG00000034713 -pdb
```
```python
# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
```
#### gget seq - Sequence Retrieval
Fetch nucleotide or amino acid sequences for genes and transcripts.
**Parameters**:
- `ens_ids`: One or more Ensembl identifiers
- `-t/--translate`: Fetch amino acid sequences instead of nucleotide
- `-iso/--isoforms`: Return all transcript variants (gene IDs only)
**Returns**: FASTA format sequences
**Examples**:
```bash
# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853
# Get all protein isoforms
gget seq -t -iso ENSG00000034713
```
```python
# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
```
### 2. Sequence Analysis & Alignment
#### gget blast - BLAST Searches
BLAST nucleotide or amino acid sequences against standard databases.
**Parameters**:
- `sequence`: Sequence string or path to FASTA/.txt file
- `-p/--program`: blastn, blastp, blastx, tblastn, tblastx (auto-detected)
- `-db/--database`:
- Nucleotide: nt, refseq_rna, pdbnt
- Protein: nr, swissprot, pdbaa, refseq_protein
- `-l/--limit`: Max hits (default: 50)
- `-e/--expect`: E-value cutoff (default: 10.0)
- `-lcf/--low_comp_filt`: Enable low complexity filtering
- `-mbo/--megablast_off`: Disable MegaBLAST (blastn only)
**Examples**:
```bash
# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10
```
```python
# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)
```
#### gget blat - BLAT Searches
Locate genomic positions of sequences using UCSC BLAT.
**Parameters**:
- `sequence`: Sequence string or path to FASTA/.txt file
- `-st/--seqtype`: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)
- `-a/--assembly`: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)
**Returns**: genome, query size, alignment positions, matches, mismatches, alignment percentage
**Examples**:
```bash
# Find genomic location in human
gget blat ATCGATCGATCGATCG
# Search in different assembly
gget blat -a mm39 ATCGATCGATCGATCG
```
```python
# Python
gget.blat("ATCGATCGATCGATCG", assembly="mouse")
```
#### gget muscle - Multiple Sequence Alignment
Align multiple nucleotide or amino acid sequences using Muscle5.
**Parameters**:
- `fasta`: Sequences or path to FASTA/.txt file
- `-s5/--super5`: Use Super5 algorithm for faster processing (large datasets)
**Returns**: Aligned sequences in ClustalW format or aligned FASTA (.afa)
**Examples**:
```bash
# Align sequences from file
gget muscle sequences.fasta -o aligned.afa
# Use Super5 for large dataset
gget muscle large_dataset.fasta -s5
```
```python
# Python
gget.muscle("sequences.fasta", save=True)
```
#### gget diamond - Local Sequence Alignment
Perform fast local protein or translated DNA alignment using DIAMOND.
**Parameters**:
- Query: Sequences (string/list) or FASTA file path
- `--reference`: Reference sequences (string/list) or FASTA file path (required)
- `--sensitivity`: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive
- `--threads`: CPU threads (default: 1)
- `--diamond_db`: Save database for reuse
- `--translated`: Enable nucleotide-to-amino acid alignment
**Returns**: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores
**Examples**:
```bash
# Align against reference
gget diamond GGETISAWESQME -ref reference.fasta --threads 4
# Save database for reuse
gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
```
```python
# Python
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
```
### 3. Structural & Protein Analysis
#### gget pdb - Protein Structures
Query RCSB Protein Data Bank for structure and metadata.
**Parameters**:
- `pdb_id`: PDB identifier (e.g., '7S7U')
- `-r/--resource`: Data type (pdb, entry, pubmed, assembly, entity types)
- `-i/--identifier`: Assembly, entity, or chain ID
**Returns**: PDB format (structures) or JSON (metadata)
**Examples**:
```bash
# Download PDB structure
gget pdb 7S7U -o 7S7U.pdb
# Get metadata
gget pdb 7S7U -r entry
```
```python
# Python
gget.pdb("7S7U", save=True)
```
#### gget alphafold - Protein Structure Prediction
Predict 3D protein structures using simplified AlphaFold2.
**Setup Required**:
```bash
# Install OpenMM first
uv pip install openmm
# Then setup AlphaFold
gget setup alphafold
```
**Parameters**:
- `sequence`: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling
- `-mr/--multimer_recycles`: Recycling iterations (default: 3; recommend 20 for accuracy)
- `-mfm/--multimer_for_monomer`: Apply multimer model to single proteins
- `-r/--relax`: AMBER relaxation for top-ranked model
- `plot`: Python-only; generate interactive 3D visualization (default: True)
- `show_sidechains`: Python-only; include side chains (default: True)
**Returns**: PDB structure file, JSON alignment error data, optional 3D visualization
**Examples**:
```bash
# Predict single protein structure
gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# Predict multimer with higher accuracy
gget alphafold sequence1.fasta -mr 20 -r
```
```python
# Python with visualization
gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)
# Multimer prediction
gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)
```
#### gget elm - Eukaryotic Linear Motifs
Predict Eukaryotic Linear Motifs in protein sequences.
**Setup Required**:
```bash
gget setup elm
```
**Parameters**:
- `sequence`: Amino acid sequence or UniProt Acc
- `-u/--uniprot`: Indicates sequence is UniProt Acc
- `-e/--expand`: Include protein names, organisms, references
- `-s/--sensitivity`: DIAMOND alignment sensitivity (default: "very-sensitive")
- `-t/--threads`: Number of threads (default: 1)
**Returns**: Two outputs:
1. **ortholog_df**: Linear motifs from orthologous proteins
2. **regex_df**: Motifs directly matched in input sequence
**Examples**:
```bash
# Predict motifs from sequence
gget elm LIAQSIGQASFV -o results
# Use UniProt accession with expanded info
gget elm --uniprot Q02410 -e
```
```python
# Python
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")
```
### 4. Expression & Disease Data
#### gget archs4 - Gene Correlation & Tissue Expression
Query ARCHS4 database for correlated genes or tissue expression data.
**Parameters**:
- `gene`: Gene symbol or Ensembl ID (with `--ensembl` flag)
- `-w/--which`: 'correlation' (default, returns 100 most correlated genes) or 'tissue' (expression atlas)
- `-s/--species`: 'human' (default) or 'mouse' (tissue data only)
- `-e/--ensembl`: Input is Ensembl ID
**Returns**:
- **Correlation mode**: Gene symbols, Pearson correlation coefficients
- **Tissue mode**: Tissue identifiers, min/Q1/median/Q3/max expression values
**Examples**:
```bash
# Get correlated genes
gget archs4 ACE2
# Get tissue expression
gget archs4 -w tissue ACE2
```
```python
# Python
gget.archs4("ACE2", which="tissue")
```
#### gget cellxgene - Single-Cell RNA-seq Data
Query CZ CELLxGENE Discover Census for single-cell data.
**Setup Required**:
```bash
gget setup cellxgene
```
**Parameters**:
- `--gene` (-g): Gene names or Ensembl IDs (case-sensitive! 'PAX7' for human, 'Pax7' for mouse)
- `--tissue`: Tissue type(s)
- `--cell_type`: Specific cell type(s)
- `--species` (-s): 'homo_sapiens' (default) or 'mus_musculus'
- `--census_version` (-cv): Version ("stable", "latest", or dated)
- `--ensembl` (-e): Use Ensembl IDs
- `--meta_only` (-mo): Return metadata only
- Additional filters: disease, development_stage, sex, assay, dataset_id, donor_id, ethnicity, suspension_type
**Returns**: AnnData object with count matrices and metadata (or metadata-only dataframes)
**Examples**:
```bash
# Get single-cell data for specific genes and cell types
gget cellxgene --gene ACE2 ABCA1 --tissue lung --cell_type "mucus secreting cell" -o lung_data.h5ad
# Metadata only
gget cellxgene --gene PAX7 --tissue muscle --meta_only -o metadata.csv
```
```python
# Python
adata = gget.cellxgene(gene=["ACE2", "ABCA1"], tissue="lung", cell_type="mucus secreting cell")
```
#### gget enrichr - Enrichment Analysis
Perform ontology enrichment analysis on gene lists using Enrichr.
**Parameters**:
- `genes`: Gene symbols or Ensembl IDs
- `-db/--database`: Reference database (supports shortcuts: 'pathway', 'transcription', 'ontology', 'diseases_drugs', 'celltypes')
- `-s/--species`: human (default), mouse, fly, yeast, worm, fish
- `-bkg_l/--background_list`: Background genes for comparison
- `-ko/--kegg_out`: Save KEGG pathway images with highlighted genes
- `plot`: Python-only; generate graphical results
**Database Shortcuts**:
- 'pathway' → KEGG_2021_Human
- 'transcription' → ChEA_2016
- 'ontology' → GO_Biological_Process_2021
- 'diseases_drugs' → GWAS_Catalog_2019
- 'celltypes' → PanglaoDB_Augmented_2021
**Examples**:
```bash
# Enrichment analysis for ontology
gget enrichr -db ontology ACE2 AGT AGTR1
# Save KEGG pathways
gget enrichr -db pathway ACE2 AGT AGTR1 -ko ./kegg_images/
```
```python
# Python with plot
gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)
```
#### gget bgee - Orthology & Expression
Retrieve orthology and gene expression data from Bgee database.
**Parameters**:
- `ens_id`: Ensembl gene ID or NCBI gene ID (for non-Ensembl species). Multiple IDs supported when `type=expression`
- `-t/--type`: 'orthologs' (default) or 'expression'
**Returns**:
- **Orthologs mode**: Matching genes across species with IDs, names, taxonomic info
- **Expression mode**: Anatomical entities, confidence scores, expression status
**Examples**:
```bash
# Get orthologs
gget bgee ENSG00000169194
# Get expression data
gget bgee ENSG00000169194 -t expression
# Multiple genes
gget bgee ENSBTAG00000047356 ENSBTAG00000018317 -t expression
```
```python
# Python
gget.bgee("ENSG00000169194", type="orthologs")
```
#### gget opentargets - Disease & Drug Associations
Retrieve disease and drug associations from OpenTargets.
**Parameters**:
- Ensembl gene ID (required)
- `-r/--resource`: diseases (default), drugs, tractability, pharmacogenetics, expression, depmap, interactions
- `-l/--limit`: Cap results count
- Filter arguments (vary by resource):
- drugs: `--filter_disease`
- pharmacogenetics: `--filter_drug`
- expression/depmap: `--filter_tissue`, `--filter_anat_sys`, `--filter_organ`
- interactions: `--filter_protein_a`, `--filter_protein_b`, `--filter_gene_b`
**Examples**:
```bash
# Get associated diseases
gget opentargets ENSG00000169194 -r diseases -l 5
# Get associated drugs
gget opentargets ENSG00000169194 -r drugs -l 10
# Get tissue expression
gget opentargets ENSG00000169194 -r expression --filter_tissue brain
```
```python
# Python
gget.opentargets("ENSG00000169194", resource="diseases", limit=5)
```
#### gget cbio - cBioPortal Cancer Genomics
Plot cancer genomics heatmaps using cBioPortal data.
**Two subcommands**:
**search** - Find study IDs:
```bash
gget cbio search breast lung
```
**plot** - Generate heatmaps:
**Parameters**:
- `-s/--study_ids`: Space-separated cBioPortal study IDs (required)
- `-g/--genes`: Space-separated gene names or Ensembl IDs (required)
- `-st/--stratification`: Column to organize data (tissue, cancer_type, cancer_type_detailed, study_id, sample)
- `-vt/--variation_type`: Data type (mutation_occurrences, cna_nonbinary, sv_occurrences, cna_occurrences, Consequence)
- `-f/--filter`: Filter by column value (e.g., 'study_id:msk_impact_2017')
- `-dd/--data_dir`: Cache directory (default: ./gget_cbio_cache)
- `-fd/--figure_dir`: Output directory (default: ./gget_cbio_figures)
- `-dpi`: Resolution (default: 100)
- `-sh/--show`: Display plot in window
- `-nc/--no_confirm`: Skip download confirmations
**Examples**:
```bash
# Search for studies
gget cbio search esophag ovary
# Create heatmap
gget cbio plot -s msk_impact_2017 -g AKT1 ALK BRAF -st tissue -vt mutation_occurrences
```
```python
# Python
gget.cbio_search(["esophag", "ovary"])
gget.cbio_plot(["msk_impact_2017"], ["AKT1", "ALK"], stratification="tissue")
```
#### gget cosmic - COSMIC Database
Search COSMIC (Catalogue Of Somatic Mutations In Cancer) database.
**Important**: License fees apply for commercial use. Requires COSMIC account credentials.
**Parameters**:
- `searchterm`: Gene name, Ensembl ID, mutation notation, or sample ID
- `-ctp/--cosmic_tsv_path`: Path to downloaded COSMIC TSV file (required for querying)
- `-l/--limit`: Maximum results (default: 100)
**Database download flags**:
- `-d/--download_cosmic`: Activate download mode
- `-gm/--gget_mutate`: Create version for gget mutate
- `-cp/--cosmic_project`: Database type (cancer, census, cell_line, resistance, genome_screen, targeted_screen)
- `-cv/--cosmic_version`: COSMIC version
- `-gv/--grch_version`: Human reference genome (37 or 38)
- `--email`, `--password`: COSMIC credentials
**Examples**:
```bash
# First download database
gget cosmic -d --email user@example.com --password xxx -cp cancer
# Then query
gget cosmic EGFR -ctp cosmic_data.tsv -l 10
```
```python
# Python
gget.cosmic("EGFR", cosmic_tsv_path="cosmic_data.tsv", limit=10)
```
### 5. Additional Tools
#### gget mutate - Generate Mutated Sequences
Generate mutated nucleotide sequences from mutation annotations.
**Parameters**:
- `sequences`: FASTA file path or direct sequence input (string/list)
- `-m/--mutations`: CSV/TSV file or DataFrame with mutation data (required)
- `-mc/--mut_column`: Mutation column name (default: 'mutation')
- `-sic/--seq_id_column`: Sequence ID column (default: 'seq_ID')
- `-mic/--mut_id_column`: Mutation ID column
- `-k/--k`: Length of flanking sequences (default: 30 nucleotides)
**Returns**: Mutated sequences in FASTA format
**Examples**:
```bash
# Single mutation
gget mutate ATCGCTAAGCT -m "c.4G>T"
# Multiple sequences with mutations from file
gget mutate sequences.fasta -m mutations.csv -o mutated.fasta
```
```python
# Python
import pandas as pd
mutations_df = pd.DataFrame({"seq_ID": ["seq1"], "mutation": ["c.4G>T"]})
gget.mutate(["ATCGCTAAGCT"], mutations=mutations_df)
```
#### gget gpt - OpenAI Text Generation
Generate natural language text using OpenAI's API.
**Setup Required**:
```bash
gget setup gpt
```
**Important**: Free tier limited to 3 months after account creation. Set monthly billing limits.
**Parameters**:
- `prompt`: Text input for generation (required)
- `api_key`: OpenAI authentication (required)
- Model configuration: temperature, top_p, max_tokens, frequency_penalty, presence_penalty
- Default model: gpt-3.5-turbo (configurable)
**Examples**:
```bash
gget gpt "Explain CRISPR" --api_key your_key_here
```
```python
# Python
gget.gpt("Explain CRISPR", api_key="your_key_here")
```
#### gget setup - Install Dependencies
Install/download third-party dependencies for specific modules.
**Parameters**:
- `module`: Module name requiring dependency installation
- `-o/--out`: Output folder path (elm module only)
**Modules requiring setup**:
- `alphafold` - Downloads ~4GB of model parameters
- `cellxgene` - Installs cellxgene-census (may not support latest Python)
- `elm` - Downloads local ELM database
- `gpt` - Configures OpenAI integration
**Examples**:
```bash
# Setup AlphaFold
gget setup alphafold
# Setup ELM with custom directory
gget setup elm -o /path/to/elm_data
```
```python
# Python
gget.setup("alphafold")
```
## Common Workflows
### Workflow 1: Gene Discovery to Sequence Analysis
Find and analyze genes of interest:
```python
# 1. Search for genes
results = gget.search(["GABA", "receptor"], species="homo_sapiens")
# 2. Get detailed information
gene_ids = results["ensembl_id"].tolist()
info = gget.info(gene_ids[:5])
# 3. Retrieve sequences
sequences = gget.seq(gene_ids[:5], translate=True)
```
### Workflow 2: Sequence Alignment and Structure
Align sequences and predict structures:
```python
# 1. Align multiple sequences
alignment = gget.muscle("sequences.fasta")
# 2. Find similar sequences
blast_results = gget.blast(my_sequence, database="swissprot", limit=10)
# 3. Predict structure
structure = gget.alphafold(my_sequence, plot=True)
# 4. Find linear motifs
ortholog_df, regex_df = gget.elm(my_sequence)
```
### Workflow 3: Gene Expression and Enrichment
Analyze expression patterns and functional enrichment:
```python
# 1. Get tissue expression
tissue_expr = gget.archs4("ACE2", which="tissue")
# 2. Find correlated genes
correlated = gget.archs4("ACE2", which="correlation")
# 3. Get single-cell data
adata = gget.cellxgene(gene=["ACE2"], tissue="lung", cell_type="epithelial cell")
# 4. Perform enrichment analysis
gene_list = correlated["gene_symbol"].tolist()[:50]
enrichment = gget.enrichr(gene_list, database="ontology", plot=True)
```
### Workflow 4: Disease and Drug Analysis
Investigate disease associations and therapeutic targets:
```python
# 1. Search for genes
genes = gget.search(["breast cancer"], species="homo_sapiens")
# 2. Get disease associations
diseases = gget.opentargets("ENSG00000169194", resource="diseases")
# 3. Get drug associations
drugs = gget.opentargets("ENSG00000169194", resource="drugs")
# 4. Query cancer genomics data
study_ids = gget.cbio_search(["breast"])
gget.cbio_plot(study_ids[:2], ["BRCA1", "BRCA2"], stratification="cancer_type")
# 5. Search COSMIC for mutations
cosmic_results = gget.cosmic("BRCA1", cosmic_tsv_path="cosmic.tsv")
```
### Workflow 5: Comparative Genomics
Compare proteins across species:
```python
# 1. Get orthologs
orthologs = gget.bgee("ENSG00000169194", type="orthologs")
# 2. Get sequences for comparison
human_seq = gget.seq("ENSG00000169194", translate=True)
mouse_seq = gget.seq("ENSMUSG00000026091", translate=True)
# 3. Align sequences
alignment = gget.muscle([human_seq, mouse_seq])
# 4. Compare structures
human_structure = gget.pdb("7S7U")
mouse_structure = gget.alphafold(mouse_seq)
```
### Workflow 6: Building Reference Indices
Prepare reference data for downstream analysis (e.g., kallisto|bustools):
```bash
# 1. List available species
gget ref --list_species
# 2. Download reference files
gget ref -w gtf -w cdna -d homo_sapiens
# 3. Build kallisto index
kallisto index -i transcriptome.idx transcriptome.fasta
# 4. Download genome for alignment
gget ref -w dna -d homo_sapiens
```
## Best Practices
### Data Retrieval
- Use `--limit` to control result sizes for large queries
- Save results with `-o/--out` for reproducibility
- Check database versions/releases for consistency across analyses
- Use `--quiet` in production scripts to reduce output
### Sequence Analysis
- For BLAST/BLAT, start with default parameters, then adjust sensitivity
- Use `gget diamond` with `--threads` for faster local alignment
- Save DIAMOND databases with `--diamond_db` for repeated queries
- For multiple sequence alignment, use `-s5/--super5` for large datasets
### Expression and Disease Data
- Gene symbols are case-sensitive in cellxgene (e.g., 'PAX7' vs 'Pax7')
- Run `gget setup` before first use of alphafold, cellxgene, elm, gpt
- For enrichment analysis, use database shortcuts for convenience
- Cache cBioPortal data with `-dd` to avoid repeated downloads
### Structure Prediction
- AlphaFold multimer predictions: use `-mr 20` for higher accuracy
- Use `-r` flag for AMBER relaxation of final structures
- Visualize results in Python with `plot=True`
- Check PDB database first before running AlphaFold predictions
### Error Handling
- Database structures change; update gget regularly: `uv pip install --upgrade gget`
- Process max ~1000 Ensembl IDs at once with gget info
- For large-scale analyses, implement rate limiting for API queries
- Use virtual environments to avoid dependency conflicts
## Output Formats
### Command-line
- Default: JSON
- CSV: Add `-csv` flag
- FASTA: gget seq, gget mutate
- PDB: gget pdb, gget alphafold
- PNG: gget cbio plot
### Python
- Default: DataFrame or dictionary
- JSON: Add `json=True` parameter
- Save to file: Add `save=True` or specify `out="filename"`
- AnnData: gget cellxgene
## Resources
This skill includes reference documentation for detailed module information:
### references/
- `module_reference.md` - Comprehensive parameter reference for all modules
- `database_info.md` - Information about queried databases and their update frequencies
- `workflows.md` - Extended workflow examples and use cases
For additional help:
- Official documentation: https://pachterlab.github.io/gget/
- GitHub issues: https://github.com/pachterlab/gget/issues
- Citation: Luebbert, L. & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836What This Does
gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.
Important: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.
Quick Start
Step 1: Create a Project Folder
mkdir -p ~/Projects/gget
Step 2: Download the Template
Click Download above, then:
mv ~/Downloads/CLAUDE.md ~/Projects/gget/
Step 3: Start Claude Code
cd ~/Projects/gget
claude
Installation
Install gget in a clean virtual environment to avoid conflicts:
# Using uv (recommended)
uv uv pip install gget
# Or using pip
uv pip install --upgrade gget
# In Python/Jupyter
import gget
Module Categories
1. Reference & Gene Information
gget ref - Reference Genome Downloads
Retrieve download links and metadata for Ensembl reference genomes.
Parameters:
species: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'-w/--which: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all-r/--release: Ensembl release number (default: latest)-l/--list_species: List available vertebrate species-liv/--list_iv_species: List available invertebrate species-ftp: Return only FTP links-d/--download: Download files (requires curl)
Examples:
# List available species
gget ref --list_species
# Get all reference files for human
gget ref homo_sapiens
# Download only GTF annotation for mouse
gget ref -w gtf -d mouse
# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which="gtf", download=True)
gget search - Gene Search
Locate genes by name or description across species.
Parameters:
searchwords: One or more search terms (case-insensitive)-s/--species: Target species (e.g., 'homo_sapiens', 'mouse')-r/--release: Ensembl release number-t/--id_type: Return 'gene' (default) or 'transcript'-ao/--andor: 'or' (default) finds ANY searchword; 'and' requires ALL-l/--limit: Maximum results to return
Returns: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL
Examples:
# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric
# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription
# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
gget info - Gene/Transcript Information
Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.
Parameters:
ens_ids: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs-n/--ncbi: Disable NCBI data retrieval-u/--uniprot: Disable UniProt data retrieval-pdb: Include PDB identifiers (increases runtime)
Returns: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript
Examples:
# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296
# Include PDB IDs
gget info ENSG00000034713 -pdb
# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
gget seq - Sequence Retrieval
Fetch nucleotide or amino acid sequences for genes and transcripts.
Parameters:
ens_ids: One or more Ensembl identifiers-t/--translate: Fetch amino acid sequences instead of nucleotide-iso/--isoforms: Return all transcript variants (gene IDs only)
Returns: FASTA format sequences
Examples:
# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853
# Get all protein isoforms
gget seq -t -iso ENSG00000034713
# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
2. Sequence Analysis & Alignment
gget blast - BLAST Searches
BLAST nucleotide or amino acid sequences against standard databases.
Parameters:
sequence: Sequence string or path to FASTA/.txt file-p/--program: blastn, blastp, blastx, tblastn, tblastx (auto-detected)-db/--database:- Nucleotide: nt, refseq_rna, pdbnt
- Protein: nr, swissprot, pdbaa, refseq_protein
-l/--limit: Max hits (default: 50)-e/--expect: E-value cutoff (default: 10.0)-lcf/--low_comp_filt: Enable low complexity filtering-mbo/--megablast_off: Disable MegaBLAST (blastn only)
Examples:
# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10
# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)
gget blat - BLAT Searches
Locate genomic positions of sequences using UCSC BLAT.
Parameters:
sequence: Sequence string or path to FASTA/.txt file-st/--seqtype: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)-a/--assembly: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)
Returns: genome, query size, alignment positions, matches, mismatches, alignment percentage
Examples:
# Find genomic location in human
gget blat ATCGATCGATCGATCG
# Search in different assembly
gget blat -a mm39 ATCGATCGATCGATCG
# Python
gget.blat("ATCGATCGATCGATCG", assembly="mouse")
gget muscle - Multiple Sequence Alignment
Align multiple nucleotide or amino acid sequences using Muscle5.
Parameters:
fasta: Sequences or path to FASTA/.txt file-s5/--super5: Use Super5 algorithm for faster processing (large datasets)
Returns: Aligned sequences in ClustalW format or aligned FASTA (.afa)
Examples:
# Align sequences from file
gget muscle sequences.fasta -o aligned.afa
# Use Super5 for large dataset
gget muscle large_dataset.fasta -s5
# Python
gget.muscle("sequences.fasta", save=True)
gget diamond - Local Sequence Alignment
Perform fast local protein or translated DNA alignment using DIAMOND.
Parameters:
- Query: Sequences (string/list) or FASTA file path
--reference: Reference sequences (string/list) or FASTA file path (required)--sensitivity: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive--threads: CPU threads (default: 1)--diamond_db: Save database for reuse--translated: Enable nucleotide-to-amino acid alignment
Returns: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores
Examples:
# Align against reference
gget diamond GGETISAWESQME -ref reference.fasta --threads 4
# Save database for reuse
gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
# Python
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
3. Structural & Protein Analysis
gget pdb - Protein Structures
Query RCSB Protein Data Bank for structure and metadata.
Parameters:
pdb_id: PDB identifier (e.g., '7S7U')-r/--resource: Data type (pdb, entry, pubmed, assembly, entity types)-i/--identifier: Assembly, entity, or chain ID
Returns: PDB format (structures) or JSON (metadata)
Examples:
# Download PDB structure
gget pdb 7S7U -o 7S7U.pdb
# Get metadata
gget pdb 7S7U -r entry
# Python
gget.pdb("7S7U", save=True)
gget alphafold - Protein Structure Prediction
Predict 3D protein structures using simplified AlphaFold2.
Setup Required:
# Install OpenMM first
uv pip install openmm
# Then setup AlphaFold
gget setup alphafold
Parameters:
sequence: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling-mr/--multimer_recycles: Recycling iterations (default: 3; recommend 20 for accuracy)-mfm/--multimer_for_monomer: Apply multimer model to single proteins-r/--relax: AMBER relaxation for top-ranked modelplot: Python-only; generate interactive 3D visualization (default: True)show_sidechains: Python-only; include side chains (default: True)
Returns: PDB structure file, JSON alignment error data, optional 3D visualization
Examples:
# Predict single protein structure
gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# Predict multimer with higher accuracy
gget alphafold sequence1.fasta -mr 20 -r
# Python with visualization
gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)
# Multimer prediction
gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)
gget elm - Eukaryotic Linear Motifs
Predict Eukaryotic Linear Motifs in protein sequences.
Setup Required:
gget setup elm
Parameters:
sequence: Amino acid sequence or UniProt Acc-u/--uniprot: Indicates sequence is UniProt Acc-e/--expand: Include protein names, organisms, references-s/--sensitivity: DIAMOND alignment sensitivity (default: "very-sensitive")-t/--threads: Number of threads (default: 1)
Returns: Two outputs:
- ortholog_df: Linear motifs from orthologous proteins
- regex_df: Motifs directly matched in input sequence
Examples:
# Predict motifs from sequence
gget elm LIAQSIGQASFV -o results
# Use UniProt accession with expanded info
gget elm --uniprot Q02410 -e
# Python
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")
4. Expression & Disease Data
gget archs4 - Gene Correlation & Tissue Expression
Query ARCHS4 database for correlated genes or tissue expression data.
Parameters:
gene: Gene symbol or Ensembl ID (with--ensemblflag)-w/--which: 'correlation' (default, returns 100 most correlated genes) or 'tissue' (expression atlas)-s/--species: 'human' (default) or 'mouse' (tissue data only)-e/--ensembl: Input is Ensembl ID
Returns:
- Correlation mode: Gene symbols, Pearson correlation coefficients
- Tissue mode: Tissue identifiers, min/Q1/median/Q3/max expression values
Examples:
# Get correlated genes
gget archs4 ACE2
# Get tissue expression
gget archs4 -w tissue ACE2
# Python
gget.archs4("ACE2", which="tissue")
gget cellxgene - Single-Cell RNA-seq Data
Query CZ CELLxGENE Discover Census for single-cell data.
Setup Required:
gget setup cellxgene
Parameters:
--gene(-g): Gene names or Ensembl IDs (case-sensitive! 'PAX7' for human, 'Pax7' for mouse)--tissue: Tissue type(s)--cell_type: Specific cell type(s)--species(-s): 'homo_sapiens' (default) or 'mus_musculus'--census_version(-cv): Version ("stable", "latest", or dated)--ensembl(-e): Use Ensembl IDs--meta_only(-mo): Return metadata only- Additional filters: disease, development_stage, sex, assay, dataset_id, donor_id, ethnicity, suspension_type
Returns: AnnData object with count matrices and metadata (or metadata-only dataframes)
Examples:
# Get single-cell data for specific genes and cell types
gget cellxgene --gene ACE2 ABCA1 --tissue lung --cell_type "mucus secreting cell" -o lung_data.h5ad
# Metadata only
gget cellxgene --gene PAX7 --tissue muscle --meta_only -o metadata.csv
# Python
adata = gget.cellxgene(gene=["ACE2", "ABCA1"], tissue="lung", cell_type="mucus secreting cell")
gget enrichr - Enrichment Analysis
Perform ontology enrichment analysis on gene lists using Enrichr.
Parameters:
genes: Gene symbols or Ensembl IDs-db/--database: Reference database (supports shortcuts: 'pathway', 'transcription', 'ontology', 'diseases_drugs', 'celltypes')-s/--species: human (default), mouse, fly, yeast, worm, fish-bkg_l/--background_list: Background genes for comparison-ko/--kegg_out: Save KEGG pathway images with highlighted genesplot: Python-only; generate graphical results
Database Shortcuts:
- 'pathway' → KEGG_2021_Human
- 'transcription' → ChEA_2016
- 'ontology' → GO_Biological_Process_2021
- 'diseases_drugs' → GWAS_Catalog_2019
- 'celltypes' → PanglaoDB_Augmented_2021
Examples:
# Enrichment analysis for ontology
gget enrichr -db ontology ACE2 AGT AGTR1
# Save KEGG pathways
gget enrichr -db pathway ACE2 AGT AGTR1 -ko ./kegg_images/
# Python with plot
gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)
gget bgee - Orthology & Expression
Retrieve orthology and gene expression data from Bgee database.
Parameters:
ens_id: Ensembl gene ID or NCBI gene ID (for non-Ensembl species). Multiple IDs supported whentype=expression-t/--type: 'orthologs' (default) or 'expression'
Returns:
- Orthologs mode: Matching genes across species with IDs, names, taxonomic info
- Expression mode: Anatomical entities, confidence scores, expression status
Examples:
# Get orthologs
gget bgee ENSG00000169194
# Get expression data
gget bgee ENSG00000169194 -t expression
# Multiple genes
gget bgee ENSBTAG00000047356 ENSBTAG00000018317 -t expression
# Python
gget.bgee("ENSG00000169194", type="orthologs")
gget opentargets - Disease & Drug Associations
Retrieve disease and drug associations from OpenTargets.
Parameters:
- Ensembl gene ID (required)
-r/--resource: diseases (default), drugs, tractability, pharmacogenetics, expression, depmap, interactions-l/--limit: Cap results count- Filter arguments (vary by resource):
- drugs:
--filter_disease - pharmacogenetics:
--filter_drug - expression/depmap:
--filter_tissue,--filter_anat_sys,--filter_organ - interactions:
--filter_protein_a,--filter_protein_b,--filter_gene_b
- drugs:
Examples:
# Get associated diseases
gget opentargets ENSG00000169194 -r diseases -l 5
# Get associated drugs
gget opentargets ENSG00000169194 -r drugs -l 10
# Get tissue expression
gget opentargets ENSG00000169194 -r expression --filter_tissue brain
# Python
gget.opentargets("ENSG00000169194", resource="diseases", limit=5)
gget cbio - cBioPortal Cancer Genomics
Plot cancer genomics heatmaps using cBioPortal data.
Two subcommands:
search - Find study IDs:
gget cbio search breast lung
plot - Generate heatmaps:
Parameters:
-s/--study_ids: Space-separated cBioPortal study IDs (required)-g/--genes: Space-separated gene names or Ensembl IDs (required)-st/--stratification: Column to organize data (tissue, cancer_type, cancer_type_detailed, study_id, sample)-vt/--variation_type: Data type (mutation_occurrences, cna_nonbinary, sv_occurrences, cna_occurrences, Consequence)-f/--filter: Filter by column value (e.g., 'study_id:msk_impact_2017')-dd/--data_dir: Cache directory (default: ./gget_cbio_cache)-fd/--figure_dir: Output directory (default: ./gget_cbio_figures)-dpi: Resolution (default: 100)-sh/--show: Display plot in window-nc/--no_confirm: Skip download confirmations
Examples:
# Search for studies
gget cbio search esophag ovary
# Create heatmap
gget cbio plot -s msk_impact_2017 -g AKT1 ALK BRAF -st tissue -vt mutation_occurrences
# Python
gget.cbio_search(["esophag", "ovary"])
gget.cbio_plot(["msk_impact_2017"], ["AKT1", "ALK"], stratification="tissue")
gget cosmic - COSMIC Database
Search COSMIC (Catalogue Of Somatic Mutations In Cancer) database.
Important: License fees apply for commercial use. Requires COSMIC account credentials.
Parameters:
searchterm: Gene name, Ensembl ID, mutation notation, or sample ID-ctp/--cosmic_tsv_path: Path to downloaded COSMIC TSV file (required for querying)-l/--limit: Maximum results (default: 100)
Database download flags:
-d/--download_cosmic: Activate download mode-gm/--gget_mutate: Create version for gget mutate-cp/--cosmic_project: Database type (cancer, census, cell_line, resistance, genome_screen, targeted_screen)-cv/--cosmic_version: COSMIC version-gv/--grch_version: Human reference genome (37 or 38)--email,--password: COSMIC credentials
Examples:
# First download database
gget cosmic -d --email user@example.com --password xxx -cp cancer
# Then query
gget cosmic EGFR -ctp cosmic_data.tsv -l 10
# Python
gget.cosmic("EGFR", cosmic_tsv_path="cosmic_data.tsv", limit=10)
5. Additional Tools
gget mutate - Generate Mutated Sequences
Generate mutated nucleotide sequences from mutation annotations.
Parameters:
sequences: FASTA file path or direct sequence input (string/list)-m/--mutations: CSV/TSV file or DataFrame with mutation data (required)-mc/--mut_column: Mutation column name (default: 'mutation')-sic/--seq_id_column: Sequence ID column (default: 'seq_ID')-mic/--mut_id_column: Mutation ID column-k/--k: Length of flanking sequences (default: 30 nucleotides)
Returns: Mutated sequences in FASTA format
Examples:
# Single mutation
gget mutate ATCGCTAAGCT -m "c.4G>T"
# Multiple sequences with mutations from file
gget mutate sequences.fasta -m mutations.csv -o mutated.fasta
# Python
import pandas as pd
mutations_df = pd.DataFrame({"seq_ID": ["seq1"], "mutation": ["c.4G>T"]})
gget.mutate(["ATCGCTAAGCT"], mutations=mutations_df)
gget gpt - OpenAI Text Generation
Generate natural language text using OpenAI's API.
Setup Required:
gget setup gpt
Important: Free tier limited to 3 months after account creation. Set monthly billing limits.
Parameters:
prompt: Text input for generation (required)api_key: OpenAI authentication (required)- Model configuration: temperature, top_p, max_tokens, frequency_penalty, presence_penalty
- Default model: gpt-3.5-turbo (configurable)
Examples:
gget gpt "Explain CRISPR" --api_key your_key_here
# Python
gget.gpt("Explain CRISPR", api_key="your_key_here")
gget setup - Install Dependencies
Install/download third-party dependencies for specific modules.
Parameters:
module: Module name requiring dependency installation-o/--out: Output folder path (elm module only)
Modules requiring setup:
alphafold- Downloads ~4GB of model parameterscellxgene- Installs cellxgene-census (may not support latest Python)elm- Downloads local ELM databasegpt- Configures OpenAI integration
Examples:
# Setup AlphaFold
gget setup alphafold
# Setup ELM with custom directory
gget setup elm -o /path/to/elm_data
# Python
gget.setup("alphafold")
Common Workflows
Workflow 1: Gene Discovery to Sequence Analysis
Find and analyze genes of interest:
# 1. Search for genes
results = gget.search(["GABA", "receptor"], species="homo_sapiens")
# 2. Get detailed information
gene_ids = results["ensembl_id"].tolist()
info = gget.info(gene_ids[:5])
# 3. Retrieve sequences
sequences = gget.seq(gene_ids[:5], translate=True)
Workflow 2: Sequence Alignment and Structure
Align sequences and predict structures:
# 1. Align multiple sequences
alignment = gget.muscle("sequences.fasta")
# 2. Find similar sequences
blast_results = gget.blast(my_sequence, database="swissprot", limit=10)
# 3. Predict structure
structure = gget.alphafold(my_sequence, plot=True)
# 4. Find linear motifs
ortholog_df, regex_df = gget.elm(my_sequence)
Workflow 3: Gene Expression and Enrichment
Analyze expression patterns and functional enrichment:
# 1. Get tissue expression
tissue_expr = gget.archs4("ACE2", which="tissue")
# 2. Find correlated genes
correlated = gget.archs4("ACE2", which="correlation")
# 3. Get single-cell data
adata = gget.cellxgene(gene=["ACE2"], tissue="lung", cell_type="epithelial cell")
# 4. Perform enrichment analysis
gene_list = correlated["gene_symbol"].tolist()[:50]
enrichment = gget.enrichr(gene_list, database="ontology", plot=True)
Workflow 4: Disease and Drug Analysis
Investigate disease associations and therapeutic targets:
# 1. Search for genes
genes = gget.search(["breast cancer"], species="homo_sapiens")
# 2. Get disease associations
diseases = gget.opentargets("ENSG00000169194", resource="diseases")
# 3. Get drug associations
drugs = gget.opentargets("ENSG00000169194", resource="drugs")
# 4. Query cancer genomics data
study_ids = gget.cbio_search(["breast"])
gget.cbio_plot(study_ids[:2], ["BRCA1", "BRCA2"], stratification="cancer_type")
# 5. Search COSMIC for mutations
cosmic_results = gget.cosmic("BRCA1", cosmic_tsv_path="cosmic.tsv")
Workflow 5: Comparative Genomics
Compare proteins across species:
# 1. Get orthologs
orthologs = gget.bgee("ENSG00000169194", type="orthologs")
# 2. Get sequences for comparison
human_seq = gget.seq("ENSG00000169194", translate=True)
mouse_seq = gget.seq("ENSMUSG00000026091", translate=True)
# 3. Align sequences
alignment = gget.muscle([human_seq, mouse_seq])
# 4. Compare structures
human_structure = gget.pdb("7S7U")
mouse_structure = gget.alphafold(mouse_seq)
Workflow 6: Building Reference Indices
Prepare reference data for downstream analysis (e.g., kallisto|bustools):
# 1. List available species
gget ref --list_species
# 2. Download reference files
gget ref -w gtf -w cdna -d homo_sapiens
# 3. Build kallisto index
kallisto index -i transcriptome.idx transcriptome.fasta
# 4. Download genome for alignment
gget ref -w dna -d homo_sapiens
Best Practices
Data Retrieval
- Use
--limitto control result sizes for large queries - Save results with
-o/--outfor reproducibility - Check database versions/releases for consistency across analyses
- Use
--quietin production scripts to reduce output
Sequence Analysis
- For BLAST/BLAT, start with default parameters, then adjust sensitivity
- Use
gget diamondwith--threadsfor faster local alignment - Save DIAMOND databases with
--diamond_dbfor repeated queries - For multiple sequence alignment, use
-s5/--super5for large datasets
Expression and Disease Data
- Gene symbols are case-sensitive in cellxgene (e.g., 'PAX7' vs 'Pax7')
- Run
gget setupbefore first use of alphafold, cellxgene, elm, gpt - For enrichment analysis, use database shortcuts for convenience
- Cache cBioPortal data with
-ddto avoid repeated downloads
Structure Prediction
- AlphaFold multimer predictions: use
-mr 20for higher accuracy - Use
-rflag for AMBER relaxation of final structures - Visualize results in Python with
plot=True - Check PDB database first before running AlphaFold predictions
Error Handling
- Database structures change; update gget regularly:
uv pip install --upgrade gget - Process max ~1000 Ensembl IDs at once with gget info
- For large-scale analyses, implement rate limiting for API queries
- Use virtual environments to avoid dependency conflicts
Output Formats
Command-line
- Default: JSON
- CSV: Add
-csvflag - FASTA: gget seq, gget mutate
- PDB: gget pdb, gget alphafold
- PNG: gget cbio plot
Python
- Default: DataFrame or dictionary
- JSON: Add
json=Trueparameter - Save to file: Add
save=Trueor specifyout="filename" - AnnData: gget cellxgene
Resources
This skill includes reference documentation for detailed module information:
references/
module_reference.md- Comprehensive parameter reference for all modulesdatabase_info.md- Information about queried databases and their update frequenciesworkflows.md- Extended workflow examples and use cases
For additional help:
- Official documentation: https://pachterlab.github.io/gget/
- GitHub issues: https://github.com/pachterlab/gget/issues
- Citation: Luebbert, L. & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836